Annotation for gene MC_14981 Login  |  Sitemap

 
Green fields are editable (Login)  Show Audits

Locus
MC_14981   (Last updated by bvalent on 2011-08-17 10:51:44.2718)   Entrez Gene Link
Chromosome/Linkage
Group
VII
Gene Symbol
AVR-Pita3
Synonyms
Gene Description
MC_14981 - AVR-Pita3 putative metalloproteinase (891 nt)
Gene Comments
This AVR-Pita family member is not active in conferring avirulence toward rice varieties containing the resistance gene Pita.
Location
Secreted Protein
Yes
Transcripts
VII:4306477..4307367 + (4306477..4306679, 4306737..4307089, 4307177..4307219, 4307286..4307367)
Overlapping Features
Interpro
InterPro IDInterPro NameProgramProgram IDMatch Location
IPR001384Peptidase M35, deuterolysinHMMPfamPF0210252-225
Evidence
GenBank Protein: gi|120564441|gb|ABM30146.1|
BROAD: MGG_14981 - metalloproteinase (891 nt)
Interaction Terms
Gene Ontology Terms
Fungal Anatomy Terms
Publications
Khang CH, Park SY, Lee YH, Valent B, Kang S.
Genome organization and evolution of the AVR-Pita avirulence gene family in the Magnaporthe grisea species complex.
Mol Plant Microbe Interact. 2008 May;21(5):658-70.
Chuma I, Isobe C, Hotta Y, Ibaragi K, Futamata N, Kusaba M, Yoshida K, Terauchi R, Fujita Y, Nakayashiki H, Valent B, Tosa Y.
Multiple Translocation of the AVR-Pita Effector Gene among Chromosomes of the Rice Blast Fungus Magnaporthe oryzae and Related Species.
PLoS Pathog. 2011 Jul;7(7):e1002147.
Mutants
Microarray
Tools
Transcript Sequence
ATGCTTTTTTTATTTATTCTCGGTTACCTTTATACCCCTGCAACTTCGGCCTTTGTAAATACCGGTACCTTTTTACAGCCAATTAACAACTATAAAGAATTTCCAAATGATATCCACGGGGTTTTAAATAAACGAGCTTATATACAACAAGGTTCTCAATGCTCGAGTTCGGAAGCCTCGGACATCCGTGGCGCGCTAGAGAGTTGTGCCGTGCTTGCCCAACATGCCTTCCATGCGGTTAAAAGCGATGAGGAATTATTCGAGTTAATTTTCAAAACCGACAGCACAGATATTCAAGACCTTGTGAAACAGAATTTTCGTAAACTTTACGACGAATGTAGTAGAAAAGAGGACGAAGTTTATATCACCTGCGAAGATGAAACTGGAAAGTGTAAAGAAAATCAAGGATACAAAAACGTTTTGGGCTACGCAAGAATTGCAAAAGAACAAATTGTTATATGCCCCAATTTCTTCAATCGACCCAAGAGCAGCAGTGAAATTACTGCAGCCAACCAAGATACTACGATTATGCATGAACTAGCGCATGTCGTTTTAGATCTCCCTAAAGACTTTGGCTACGAATGGAAGGGAGTTCATGAGTTGGATAGTACGAAAAGTATCAAAAATCCTGACAGTTATGTTATCTTTGCACAATGTGCACGATATGGAAGTTGTTATTGA
Translated Sequence
MLFLFILGYLYTPATSAFVNTGTFLQPINNYKEFPNDIHGVLNKRAYIQQGSQCSSSEASDIRGALESCAVLAQHAFHAVKSDEELFELIFKTDSTDIQDLVKQNFRKLYDECSRKEDEVYITCEDETGKCKENQGYKNVLGYARIAKEQIVICPNFFNRPKSSSEITAANQDTTIMHELAHVVLDLPKDFGYEWKGVHELDSTKSIKNPDSYVIFAQCARYGSCY*

Instructions:
This screen serves to display annotation information for a gene and provide the mechanism for updating such information. Updateable information is denoted by a green label in the left hand column of the table above.
  1. If you would like to add or update the annotation information for a gene, you must first Login to the MGOS system by clicking the 'Login' link in the upper right-hand corner of the screen (if you are not already logged in).
  2. To update the Gene Symbol, Synonyms, Gene Description, Gene Comments, or Secreted Protein status simply click the pencil icon located next to the field to be edited; this will cause a text edit box, a save icon, and a cancel icon to appear in place of the pencil. Enter the new value in the text box and click the save icon (which looks like a diskette) to save your changes.
  3. To change or add transcript, gene ontology, fungal anatomy, publication, or mutant data for a gene you should either click the pencil next to the item to be changed to edit the data, or the 'Add a ...' link for the appropriate section. You will then be redirected to a new screen to add or update the data, which will have additional instructions at the bottom of the screen.