Annotation for gene MC_13863 Login  |  Sitemap

 
Green fields are editable (Login)  Show Audits

Locus
MC_13863   (Last updated by bvalent on 2011-08-16 11:23:33.472741)   Entrez Gene Link
Chromosome/Linkage
Group
III
Gene Symbol
PWL2
Synonyms
PHI:42 on PHI-base
Gene Description
MC_13863 - PWL2 (438 nt)
Gene Comments
Avirulence gene conferring host species specificity. Prevents strains from infecting weeping lovegrass, Eragrostis curvula. BAS gene encoding Biotrophy-Associated Secreted protein. Specifically expressed during biotrophic invasion. This gene is a duplicate of MGG_04301.6.
Location
Secreted Protein
Yes
Transcripts
III:5954534..5954971 - (5954534..5954971)
Overlapping Features
Interpro
Evidence
GenBank Protein: gi|899113|gb|AAA91019.1|
GenBank Protein: gi|1589246|prf||2210377C
GenBank Protein: gi|19705601|gb|AAA80239.2|
GenBank Protein: gi|1045536|gb|AAA80241.1|
BROAD: MGG_13863 - conserved hypothetical protein (438 nt)
Interaction Terms
Gene Ontology Terms
Fungal Anatomy Terms
Publications
Kang S, Sweigard JA, Valent B.
The PWL host specificity gene family in the blast fungus Magnaporthe grisea.
Mol Plant Microbe Interact. 1995 Nov;8(6):939-48.
Baldwin TK, Winnenburg R, Urban M, Rawlings C, Koehler J, Hammond-Kosack KE.
The pathogen-host interactions database (PHI-base) provides insights into generic and novel themes of pathogenicity.
Mol Plant Microbe Interact. 2006 Dec;19(12):1451-62.
Winnenburg R, Urban M, Beacham A, Baldwin TK, Holland S, Lindeberg M, Hansen H, Rawlings C, Hammond-Kosack KE, Köhler J.
PHI-base update: additions to the pathogen host interaction database.
Nucleic Acids Res. 2008 Jan;36(Database issue):D572-6.
Sweigard JA, Carroll AM, Kang S, Farrall L, Chumley FG, Valent B.
Identification, cloning, and characterization of PWL2, a gene for host species specificity in the rice blast fungus.
Plant Cell. 1995 Aug;7(8):1221-33.
Mutants
Microarray
Probe: A_98_P20149 - (MG04301.1) hypothetical protein ( (U26313) Pwl2 protein [Magnaporthe grisea] )
GSE1945 - Germination and appressorium formation in Magnaporthe grisea
GSM34770GSM34771GSM34785GSM34788GSM34789GSM34790GSM34791GSM34792GSM34793GSM34794
0.44-0.420.570.140.350.320.090.160.07
GSE2716 - Gene Expression in the Rice Blast Fungus, Magnaporthe grisea, During Nitrogen Starvation
GSM52503GSM52520GSM52523GSM52524GSM52525GSM52526
-0.6-0.20.70.2-0.1-0.3
GSE12598 - Expression data from Magnaporthe oryzae (M. grisea) in response to darkness
GSM315742GSM315743GSM315744GSM315745GSM315746GSM315747GSM315748GSM315749GSM315750GSM315751GSM315752GSM315753GSM315754GSM315755GSM315756
0-0.1400.1120.0638-0.10.00812-0.10.2530.0742-0.34-0.080.0969-0.540
Probe: A_98_P121913 - Pwl1 protein [Magnaporthe grisea]
GSE10173 - Appressorium induction by cyclic AMP in Magnaporthe grisea
GSM257141GSM257142GSM257143GSM257144
0.1-0.030.220.01
GSE8517 - Magnaporthe oryzae Gene Expression During Biotrophic Invasion of Rice (Agilent Array, G4137B)
GSM209699GSM209711GSM209717GSM209725GSM209728GSM209737GSM209802GSM209807GSM209808GSM209809GSM209833GSM209836
-6.196.34-5.96-5.876.016.64-6.155.61-5.955.12-5.785.08
Tools
Transcript Sequence
ATGAAATGCAACAACATCATCCTCCCTTTTGCTTTGGTCTTTTTTTCGACCACTGTAACCGCCGGTGGCGGGTGGACTAACAAACAATTTTACAACGACAAAGGCGAAAGAGAGGGCTCAATTTCAATTAGGAAGGGCTCGGAAGGCGATTTTAACTATGGCCCCAGTTATCCTGGAGGGCCCGATAGGATGGTACGGGTTCATGAAAACAACGGCAACATCCGCGGGATGCCCCCGGGATATTCTCTAGGCCCTGATCATCAGGAAGATAAAAGCGATCGTCAATATTATAACAGGCACGGATATCATGTTGGTGATGGACCCGCCGAATACGGAAATCACGGAGGCGGGCAATGGGGCGACGGATATTATGGACCGCCAGGCGAGTTTACACATGAGCACCGTGAACAGCGAGAAGAGGGCTGCAATATTATGTAA
Translated Sequence
MKCNNIILPFALVFFSTTVTAGGGWTNKQFYNDKGEREGSISIRKGSEGDFNYGPSYPGGPDRMVRVHENNGNIRGMPPGYSLGPDHQEDKSDRQYYNRHGYHVGDGPAEYGNHGGGQWGDGYYGPPGEFTHEHREQREEGCNIM*

Instructions:
This screen serves to display annotation information for a gene and provide the mechanism for updating such information. Updateable information is denoted by a green label in the left hand column of the table above.
  1. If you would like to add or update the annotation information for a gene, you must first Login to the MGOS system by clicking the 'Login' link in the upper right-hand corner of the screen (if you are not already logged in).
  2. To update the Gene Symbol, Synonyms, Gene Description, Gene Comments, or Secreted Protein status simply click the pencil icon located next to the field to be edited; this will cause a text edit box, a save icon, and a cancel icon to appear in place of the pencil. Enter the new value in the text box and click the save icon (which looks like a diskette) to save your changes.
  3. To change or add transcript, gene ontology, fungal anatomy, publication, or mutant data for a gene you should either click the pencil next to the item to be changed to edit the data, or the 'Add a ...' link for the appropriate section. You will then be redirected to a new screen to add or update the data, which will have additional instructions at the bottom of the screen.