Annotation for gene MC_08275 Login  |  Sitemap

 
Green fields are editable (Login)  Show Audits

Locus
MC_08275   (Last updated by bvalent on 2011-05-09 10:30:37.695804)   Entrez Gene Link
Chromosome/Linkage
Group
I
Gene Symbol
Synonyms
Gene Description
MC_08275 - hypothetical protein (1323 nt)
Gene Comments
Unpublished mutant data from the Terauchi Lab showed no phenotype.
Location
Secreted Protein
No
Transcripts
I:8180145..8181467 - (8181228..8181467, 8180968..8181083, 8180145..8180875)
I:8180541..8181385 - (8181228..8181385, 8180968..8181083, 8180541..8180875)
Overlapping Features
Interpro
Evidence
SAGE Tag: CATGTGTGTGTGTGTGTGTGT
SAGE Tag: CATGGAAATTTTCTTTTCCCT
SAGE Tag: CATGTATGCAATACCATCGCT
BROAD: MGG_08275 - hypothetical protein (1323 nt)
EST Contig: mgu_00648
EST Contig: mgu_12964
Interaction Terms
Gene Ontology Terms
GO:0044408 - growth or development of symbiont on or near host
IEP: Inferred from Expression Pattern
Shaowu Meng, Douglas E Brown, Daniel J Ebbole, Trudy Torto-Alalibo, Yeon Yee Oh, Jixin Deng, Thomas K Mitchell and Ralph A Dean
GO:0044408 - growth or development of symbiont on or near host
IEP: Inferred from Expression Pattern
GO:0051591 - response to cAMP
IEP: Inferred from Expression Pattern
Shaowu Meng, Douglas E Brown, Daniel J Ebbole, Trudy Torto-Alalibo, Yeon Yee Oh, Jixin Deng, Thomas K Mitchell and Ralph A Dean
Fungal Anatomy Terms
Publications
Terauchi, Ryohei et al.
Unpublished mutant data
. 2008 Nov;():.
Shaowu Meng, Douglas E Brown, Daniel J Ebbole, Trudy Torto-Alalibo, Yeon Yee Oh, Jixin Deng, Thomas K Mitchell and Ralph A Dean.
Gene Ontology annotation of the rice blast fungus, Magnaporthe oryzae
BMC Microbiology. 2009 Feb;9(Suppl1):S8.
Gowda M, Venu RC, Raghupathy MB, Nobuta K, Li H, Wing R, Stahlberg E, Couglan S, Haudenschild CD, Dean R, Nahm BH, Meyers BC, Wang GL.
Deep and comparative analysis of the mycelium and appressorium transcriptomes of Magnaporthe grisea using MPSS, RL-SAGE, and oligoarray methods.
BMC Genomics. 2006 Dec;7():310.
Mutants
MC58:Ina72pSfinx code:Mg136; EcoTILLING code:RU397Conidiation: Normal
Conidial germination: Normal
Appressorium Formation: Normal
Appressorial Penetration: Normal
Invasive growth: Normal
Pathogenicity: Normal pathogenecity
Microarray
Probe: A_98_P11991 - (MG08275.1) predicted protein
GSE1945 - Germination and appressorium formation in Magnaporthe grisea
GSM34770GSM34771GSM34785GSM34788GSM34789GSM34790GSM34791GSM34792GSM34793GSM34794
0.85-1.67-0.240.090.6-2.960.331.32-0.872.59
GSE2716 - Gene Expression in the Rice Blast Fungus, Magnaporthe grisea, During Nitrogen Starvation
GSM52503GSM52520GSM52523GSM52524GSM52525GSM52526
-1.5-10.9-0.90.5-0.4
GSE12598 - Expression data from Magnaporthe oryzae (M. grisea) in response to darkness
GSM315742GSM315743GSM315744GSM315745GSM315746GSM315747GSM315748GSM315749GSM315750GSM315751GSM315752GSM315753GSM315754GSM315755GSM315756
00.117000-0.3-0.110.291-0.0400.03990.0943-0.74-0.160
Probe: A_98_P140925 - Hypothetical protein
GSE10173 - Appressorium induction by cyclic AMP in Magnaporthe grisea
GSM257141GSM257142GSM257143GSM257144
0.22-0.060.480.04
GSE8517 - Magnaporthe oryzae Gene Expression During Biotrophic Invasion of Rice (Agilent Array, G4137B)
GSM209699GSM209711GSM209717GSM209725GSM209728GSM209737GSM209802GSM209807GSM209808GSM209809GSM209833GSM209836
0-0.380.150.030.30-0.6600000
Tools
Transcript Sequence
CACAATTCTACCACGCTTCAGCAAATAATTGCCCTTTGTAACTCTAATCTTAATATCCTCCAAACGAGAAAACATCACAAAAATGGTCGCCATCAAACCACTCATCCTCCTGGGACTTGCCGCAAATGCAGCTGCTGCAGGTCACGGCCAACAGCATGCCAATGCATTGCATGCCAGGCAAGACTATGGCAAGGGCAAAGGAGGCGGCTCGAAATGCGGCAAGCTGAACTTTGTCTTTACCGGCCTACCGTGGAACCACCCAGCAGTCCAGGCTGCAGGTTTTAACCCAGCAATGGTCGAGGCTGCCATCAAGTTTGATGTACAGCAAATCGTGCAAGCTGGCTATAACATAAAGGCCATTCTTGTGGGCCCCGAAGACCCCATCAGCGACATCGCAGAAGAGATGGACAACGTCCCCGGGGTCAAGGAGTGGACGGGAACGGGAGTGGGCTACGGGCTGCGCGGGCCCAACAGCACGGTGCTGACGGTCAGGTTCACCGACGTGATCCAGCTCTTCCGGGACAAGGAGCCAAACGCACCCATCCTGTTCAACCACTCGCCCACCACCAGCCTGTGGGCCATTCAGCAAAAGTTCCCGCTGCCGGCCGGGACCAACTGCTCGGCCGAGGGCAAGCCGGGCAAGAACTATGGCATTGCCGTCCACTGCAGTGCTTGTCCGCCGTCAAACTAGCCTAGGTCTAGGTCTAGATCTAGGATTGGAAATGGATAGACAAAAAGGAGGAAAAAAAGGAGTACCGGTAAAAGGCAGGGCGGCTTGTGTCCAGCACCGCACACTATTGTAGTAGTGGCAAGGCGAGGTGGCAAGGAAACTTGAAAGGTGCCTTGGAGGGTGGCAGAGTTTCAGCCAAGCGAGAGAGGCTGCCAAGCTGCATATGGTGTGTGTGGCAAGGGTTTATCATTTGAGATATTATTATCGTGTGCGTGGGTGGCACGGAAGCAAAGCTTTGCAAGGCTTTGCAAGGCTTGGTACTGTATTGTACAGAGTATGGTACCAAGGGTACATACCTTTTTTTACCTTGATCTAATTATTTCCATAGCAGCGATGGTATTGCATACATGGAAATTT
Translated Sequence
MVAIKPLILLGLAANAAAAGHGQQHANALHARQDYGKGKGGGSKCGKLNFVFTGLPWNHPAVQAAGFNPAMVEAAIKFDVQQIVQAGYNIKAILVGPEDPISDIAEEMDNVPGVKEWTGTGVGYGLRGPNSTVLTVRFTDVIQLFRDKEPNAPILFNHSPTTSLWAIQQKFPLPAGTNCSAEGKPGKNYGIAVHCSACPPSN*

Instructions:
This screen serves to display annotation information for a gene and provide the mechanism for updating such information. Updateable information is denoted by a green label in the left hand column of the table above.
  1. If you would like to add or update the annotation information for a gene, you must first Login to the MGOS system by clicking the 'Login' link in the upper right-hand corner of the screen (if you are not already logged in).
  2. To update the Gene Symbol, Synonyms, Gene Description, Gene Comments, or Secreted Protein status simply click the pencil icon located next to the field to be edited; this will cause a text edit box, a save icon, and a cancel icon to appear in place of the pencil. Enter the new value in the text box and click the save icon (which looks like a diskette) to save your changes.
  3. To change or add transcript, gene ontology, fungal anatomy, publication, or mutant data for a gene you should either click the pencil next to the item to be changed to edit the data, or the 'Add a ...' link for the appropriate section. You will then be redirected to a new screen to add or update the data, which will have additional instructions at the bottom of the screen.