Annotation for gene MC_06951 Login  |  Sitemap

 
Green fields are editable (Login)  Show Audits

Locus
MC_06951   (Last updated by bvalent on 2011-05-09 10:09:25.018962)   Entrez Gene Link
Chromosome/Linkage
Group
II
Gene Symbol
Synonyms
Gene Description
MC_06951 - CAAX prenyl protease 1 (1562 nt)
Gene Comments
Unpublished mutant data from the Terauchi Lab showed no phenotype.
Location
Secreted Protein
No
Transcripts
II:3468404..3469965 - (3469951..3469965, 3468908..3469837, 3468404..3468838)
Overlapping Features
Interpro
InterPro IDInterPro NameProgramProgram IDMatch Location
IPR001915Peptidase M48, Ste24pHMMPfamPF01435237-430
Evidence
SAGE Tag: CATGGACGCCGACTGGATGTA
BROAD: MGG_06951 - CAAX prenyl protease 1 (1562 nt)
EST Contig: mgu_02919
EST Contig: mgu_00892
Interaction Terms
Gene Ontology Terms
GO:0009405 - pathogenesis
IEA: Inferred from Electronic Annotation
GO:0009405 - pathogenesis
IMP: Inferred from Mutant Phenotype
Fungal Anatomy Terms
Publications
Terauchi, Ryohei et al.
Unpublished mutant data
. 2008 Nov;():.
Jeon J, Park SY, Chi MH, Choi J, Park J, Rho HS, Kim S, Goh J, Yoo S, Choi J, Park JY, Yi M, Yang S, Kwon MJ, Han SS, Kim BR, Khang CH, Park B, Lim SE, Jung K, Kong S, Karunakaran M, Oh HS, Kim H, Kim S, Park J, Kang S, Choi WB, Kang S, Lee YH.
Genome-wide functional analysis of pathogenicity genes in the rice blast fungus.
Nat Genet. 2007 Apr;39(4):561-5.
Shaowu Meng, Douglas E Brown, Daniel J Ebbole, Trudy Torto-Alalibo, Yeon Yee Oh, Jixin Deng, Thomas K Mitchell and Ralph A Dean.
Gene Ontology annotation of the rice blast fungus, Magnaporthe oryzae
BMC Microbiology. 2009 Feb;9(Suppl1):S8.
Baldwin TK, Winnenburg R, Urban M, Rawlings C, Koehler J, Hammond-Kosack KE.
The pathogen-host interactions database (PHI-base) provides insights into generic and novel themes of pathogenicity.
Mol Plant Microbe Interact. 2006 Dec;19(12):1451-62.
Winnenburg R, Urban M, Beacham A, Baldwin TK, Holland S, Lindeberg M, Hansen H, Rawlings C, Hammond-Kosack KE, Köhler J.
PHI-base update: additions to the pathogen host interaction database.
Nucleic Acids Res. 2008 Jan;36(Database issue):D572-6.
Choi J, Park J, Jeon J, Chi MH, Goh J, Yoo SY, Park J, Jung K, Kim H, Park SY, Rho HS, Kim S, Kim BR, Han SS, Kang S, Lee YH.
Genome-wide analysis of T-DNA integration into the chromosomes of Magnaporthe oryzae.
Mol Microbiol. 2007 Oct;66(2):371-82.
Mutants
HM88:70-15Conidiation: Normal
Conidial germination: Normal
Appressorium Formation: Normal
Appressorial Penetration: Normal
Invasive growth: Normal
Pathogenicity: Normal pathogenecity
PHI-base: 807gene disruptionPathogenicity: Reduced pathogenic
Appressorium Formation: reduced appressorium formation
ATMT0550B5Gene replacementGrowth: Increased
Conidiation: High
Conidial germination: Decreased
Appressorium Formation: reduced appressorium formation
Pigmentation: Gray
Conidial morphology: Normal
Pathogenicity: Reduced pathogenic
Microarray
Probe: A_98_P10104 - (MG06951.1) hypothetical protein
GSE1945 - Germination and appressorium formation in Magnaporthe grisea
GSM34770GSM34771GSM34785GSM34788GSM34789GSM34790GSM34791GSM34792GSM34793GSM34794
-0.80.67-0.620.420.610.210.560.080.45-0.02
GSE2716 - Gene Expression in the Rice Blast Fungus, Magnaporthe grisea, During Nitrogen Starvation
GSM52503GSM52520GSM52523GSM52524GSM52525GSM52526
1.10.40.80.10-0.9
GSE12598 - Expression data from Magnaporthe oryzae (M. grisea) in response to darkness
GSM315742GSM315743GSM315744GSM315745GSM315746GSM315747GSM315748GSM315749GSM315750GSM315751GSM315752GSM315753GSM315754GSM315755GSM315756
-0.31-0.34-0.42-0.27-0.240.01450.0738-0.31-1.08-0.880.0651-0.02-0.030.01890.0933
Probe: A_98_P176228 - probable zinc metallo-protease [Neurospora crassa]
GSE10173 - Appressorium induction by cyclic AMP in Magnaporthe grisea
GSM257141GSM257142GSM257143GSM257144
GSE8517 - Magnaporthe oryzae Gene Expression During Biotrophic Invasion of Rice (Agilent Array, G4137B)
GSM209699GSM209711GSM209717GSM209725GSM209728GSM209737GSM209802GSM209807GSM209808GSM209809GSM209833GSM209836
-1.770.96-1.15-1.071.290.96-1.691.32-2.522.33-2.532.34
Tools
Transcript Sequence
ATGGATTTTCTACAGCGTCTCGCGCGGTTCTTGGACCGTCCGCTATTTCCCTGGAAGAAGCTGATCGTTGGCTTCTCCCTCGCCCACTACTTCTTCGAAAGCTTCTTGTCTCTCCGCCAGTACCAGGTCCTCCAAAAGACCAAGCCTCCCAAAGTTCTCGAGCAGCAAATCTCGCAGGAAGTCTTTGACAAGAGTCAGGCTTATGGTCGCGCAAAGGCCAAGTACGGTTTCGTCAGCAAGCTTTGGGGCCAGATCCAGAACATCGCCTTTATACAATATGACGTCCTGCCCAAGCTTTGGGCGTGGTCGGGTAGACTGCTGCTCAGCTATGCGCCTGCCCGCTTCACCGGAGAAATCTCGCAGTCCATCGTCTTCGTCCTCGCCTTCGTCATGATCCAACAGGTTCTCTCGCTGCCCACCTCGATCTATCACACCTTCGTCCTCGAGGAGAAGTTCGGATTCAACAAGCAAACCCCCAAGCTCTTCATCACGGATCTCATCAAGTCTCAGCTGCTCACCGTCGTCCTTACCCCGCCCATCCTGGCTGGTTTCCTCAAGATCATCCAAAAGACTGGTGACCAGTTCTTCTACTACCTCTGGATGTTCGGTGCCTTCCTCCAGGTCTTCATGATTACCGTCTACCCGATCGCCATTCTGCCTCTGTTTAACAAGCTGTCTCCGCTGGAACCTGGCGAGCTCAAGACAGGAGTCGAGGCTTTGGCCAAGAGGCTCAACTTTCCGCTGCACGAGCTCTATGTGATTGATGGTAGCAAGCGCTCTGCTCACAGCAACGCCTATTTCTTTGGCCTGCCGTGGAAGAAGCACATTGTCATCTACGATACCTTGATTGAGAAGAGCGAAACCCAGGAGGTCGTTGCTGTGCTCGCGCACGAGCTTGGCCACTGGAAGCTAGGCCACACCACCAGCCTGTTTGGCATTGCTCAGGCGCACTTCTTCTACATCTTCACGCTCTTTTCCGTTTTCATCAACAACAAGTCTCTCTATGCCGACTTTGGGTTTGTTCTTGAGCGACCCATCATCATTGGCTTCCTGCTCTTCTCTGATGCGCTCGCGCCTATGGATGTTCTTATCCAGCTGGGTATGAACATTCTTAGCCGCAAGTTCGAGTTCCAGGCCGATGACTTCGCCAAGGGCCTTGGATACCCGGTTGAACTGGCACGGTCTCTCATTAAGCTCCAGATTCAGAACCTGAGCAACATGGACGCCGACTGGATGTACGCTAGCTACCACTTCTCGCACCCGATTCTGTCAGAGAGGCTTAGGGCGCTTGGATGGCAGTCAAACGAGAAGATTGATATCAAGGAGAAGAAGAAGACAGATGAGGGTGTGGTCAAGGCCTCGGGCAGAGATGAATTGTAG
Translated Sequence
MDFLQRLARFLDRPLFPWKKLIVGFSLAHYFFESFLSLRQYQVLQKTKPPKVLEQQISQEVFDKSQAYGRAKAKYGFVSKLWGQIQNIAFIQYDVLPKLWAWSGRLLLSYAPARFTGEISQSIVFVLAFVMIQQVLSLPTSIYHTFVLEEKFGFNKQTPKLFITDLIKSQLLTVVLTPPILAGFLKIIQKTGDQFFYYLWMFGAFLQVFMITVYPIAILPLFNKLSPLEPGELKTGVEALAKRLNFPLHELYVIDGSKRSAHSNAYFFGLPWKKHIVIYDTLIEKSETQEVVAVLAHELGHWKLGHTTSLFGIAQAHFFYIFTLFSVFINNKSLYADFGFVLERPIIIGFLLFSDALAPMDVLIQLGMNILSRKFEFQADDFAKGLGYPVELARSLIKLQIQNLSNMDADWMYASYHFSHPILSERLRALGWQSNEKIDIKEKKKTDEGVVKASGRDEL*

Instructions:
This screen serves to display annotation information for a gene and provide the mechanism for updating such information. Updateable information is denoted by a green label in the left hand column of the table above.
  1. If you would like to add or update the annotation information for a gene, you must first Login to the MGOS system by clicking the 'Login' link in the upper right-hand corner of the screen (if you are not already logged in).
  2. To update the Gene Symbol, Synonyms, Gene Description, Gene Comments, or Secreted Protein status simply click the pencil icon located next to the field to be edited; this will cause a text edit box, a save icon, and a cancel icon to appear in place of the pencil. Enter the new value in the text box and click the save icon (which looks like a diskette) to save your changes.
  3. To change or add transcript, gene ontology, fungal anatomy, publication, or mutant data for a gene you should either click the pencil next to the item to be changed to edit the data, or the 'Add a ...' link for the appropriate section. You will then be redirected to a new screen to add or update the data, which will have additional instructions at the bottom of the screen.